Bircher-Benner: (Hand)buch Nr. 4 für Frischsäfte, Rohkost und Früchtspeisen

Inhaltsverzeichnis

Inhaltsverzeichnis zu „Bircher-Benner-Handbuch: Bd.4 Bircher-Benner Handbuch für Frischsäfte, Rohkost und Früchtespeisen“
Einleitung 5
Zweierlei Nahrungsenergie7
Die neue Ordnung der Nahrungsmittel nach ihrem qualitiven Nährwert 9
Das Grundsystem des zarten Bindegewebes, Ursprung der Entstehung chronischer Krankheiten 11
Das Experiment im Royal Free Hospital in London 15
Einige weitere ausgewählte Beispiele wissenschaftlicher Untersuchungen zur Wirkung der Rohkosttherapie 19
Sekundäre Pflanzenstoffe, Arzneiwirkung pflanzlicher Nahrungsmittel 21
Zur Rohkosttherapie bei Gefahr von Thrombose und Embolie 26
Besonderheiten der Rohkosttherapie gegen Bluthochdruck 26
Besonderheiten der Rohkosttherapie zur Senkung des Cholesterinsspiegels 27
Zur Rohkosttherapie bei Diabetes mellitus 27
Zur Rohkosttherapie bei Infektionskrankheiten antimikrobielle Wirkung) 29
Zur Rohkosttherapie bei Immunschwäche und Infekt
anfälligkeit 29
Die Indikation zur Diät mit vegetabiler Frischkost
(Rohkost) 30
Die Diätstufe 1 32
Die Diätstufe 2 34
Formen vegetabiler Frischkost 35
Reaktionen auf die Umstellung auf die vegetabilen
Frischkostdiät und ihre Behandlung 37
Begleitende, allgemeine Empfehlungen zur vegetabilen
Frischsaftdiät 40
Die neue Gleichgewichtslage 41
Die verjüngende Wirkung der vitalen vegetabilen
Frischkost 44
Die richtige Anfangsdosierung 45
Das Thema der sogenannten "Rohkostintoleranz" 47
Die Zubereitung und Reinigung der Rohkost 47
Die Zusammenstellung der Rohkost 48
Die Anpassung an Geschmack und Kaufähigkeit 48
Die Reinigung der Rohkost 49
Von der Bircher-Raffel zur elektrischen Küchenmaschine 50
Speisezettel 51
Menü-Zusammenstellungen bei verschiedenen
Rohkost-Diätformen 51
Die Rezepte 55
Müesli 55
Früchte-Frischkorn-Speisen 57
Früchte-Speisen 57
Säfte 59
Schleim als Zusatz zu Säften 60
Milcharten 61
Saucen zu Rohgemüsen 62
Salatgerichte 62
Gesundheits-Tees 65
Stichwortverzeichnis 67
Literaturverzeichnis 68
Band 4

Bircher-Benner: (Hand)buch Nr. 4 für Frischsäfte, Rohkost und Früchtspeisen

Über neueste biophysikalische-wissenschaftliche Erkenntnisse zur Lebensenergie, Nahrunsenergie, Wirkung der lebendigen, vegetarischen Frischkost

Buch (Taschenbuch)

49,90 €

inkl. gesetzl. MwSt.

Beschreibung

Details

Verkaufsrang

40004

Einband

Taschenbuch

Erscheinungsdatum

01.09.2014

Illustrator

Kösel Media GmbH

Herausgeber

Andres Bircher

Verlag

Bircher-Benner

Beschreibung

Rezension

Bircher-Benner-Diät hat höchsten Heilwert:
Darum empfehlen Ärzte, Ernährungswissenschaftler und Diätassistentinnen unsere Bircher-Benner-Diätbücher
Einige Beurteilungen:
Prof. Dr.med. Halden, Graz:
„Ich finde die Büchlein ausgezeichnet. Neben vielen Kurplänen, Rezepten und Speiseplänen für eine hilfreiche und wohlschmeckende Diät werden erprobte Anleitungen für eine schützende und aufbauende Lebensführung gebracht, die das Verständnis für die ärztlichen Verordnungen fördern.
Dr.med. Klimcyk im Deutschen Medizinischen Journal:
„Für den Arzt eine wesentliche Zeitersparnis und für den Patienten eine grosse Hilfe.“
Prof. Dr.med. K. Kötschau, Schlossberg bei Rosenheim:
„Diese Bücher rangieren also vor aller Medizin, denn sie verschaffen die Chance, fast jedem Krankheitsfall, ja auch so mancher Krankheitsverschlimmerung vorzubeugen. Das ist meine ärztliche Überzeugung, zu der ich in jahrzehntelanger Beschäftigung mit der vorbeugenden Gesundheitspflege gekommen bin.“
Dr.med. W.Matzke in der Österreichischen Ärztezeitung:
„Es ist an alles gedacht, und alles ist wohldurchdacht. Das ist der besondere Wert dieser Diätbuchreihe, Jeder Arzt sollte sie seinen Patienten empfehlen.“
Dr.med. J.v. Mengershausen, Bayrischzell:
„Max Bircher-Benner war der führende Bahnbrecher dieser natürlichen Diätetik und Lebensordnung. Aus breiten und langjährigen Erfahrung seiner berühmten Klinik ist die Reihe der Bircher-Benner-Handbücher für die wichtigsten Krankheitsgruppen hervorgegangen, die jedem Heilungssuchenden bestens empfohlen werden können.“
Prof. Dr. med. Mommsen, Frankfurt/M.:
„Diese Bücher sind für jeden Arzt eine wertvolle Hilfe in der Führung seiner Patienten. Sie zeigen dem Kranken und dem Krankheitsgefährdeten, wie er durch richtige Ernährung wieder zu Gesundheit und Widerstandskraft gelangen kann. Erstaunt wird der Leser feststellen, wie abwechslungsreich eine Diät sein kann. Es ist nicht notwendig, auf die Freuden guter Mahlzeiten zu verzichten. Ich wünsche den Büchern weiteste Verbreitung und bin überzeugt, dass die Krankheitsanfälligkeit und die daraus folgenden hohen Belegzahlen unserer Krankenhäuser entscheidend gesenkt werden könnten, wenn die Ernährungsratschläge der Bircher-Benner-Diätbücher von der Mehrheit unserer Bevölkerung befolgt würden.“
Dr. med. Schoeler in der Allg. Homöopathischen Zeitung:
„Es ist für Arzt und Patient am zweckmässigsten und für den Erfolg am sichersten, sich dieser preiswerten und praktischen Diätbücher zu bedienen.“
Prof. Dr..med. H. Warning, Saarbrücken:
„Seit dem Bestehen dieser Diätbuchreihe bemühen sich viele geistesverwandte Autoren, etwas Gleichwertiges und Umfassendes auf den Diätbüchermarkt zu bringen, das für den diätetisch informierten Fachmann und das breite Publikum gleichermassen praktikabel. So weit ich sehe, ist das bisher nur unvollständig gelungen. So marschiert denn die Bircher-Benner-Diätbuchreihe wie ehedem an der Spitze ihres Genres.“
Dr.med. J. Zinke „Klassische Homöopathie“:
„Die Diätbücher des Bircher-Benner-Verlages stellen wohl das Beste dar, was auf diesem Gebiet zur Zeit im Handel ist. Für den behandelnden Arzt bedeuten sie eine grosse Zeitersparnis, für den Patienten eine überaus wertvolle Hilfe.“

Details

Verkaufsrang

40004

Einband

Taschenbuch

Erscheinungsdatum

01.09.2014

Illustrator

Kösel Media GmbH

Herausgeber

Andres Bircher

Verlag

Bircher-Benner

Seitenzahl

78

Maße (L/B/H)

21,1/15,1/1 cm

Gewicht

163 g

Auflage

32. Auflage

Sprache

Deutsch

ISBN

978-2-9700722-3-2

Weitere Bände von Bircher-Benner-Handbuch

Unsere Kundinnen und Kunden meinen

0.0

0 Bewertungen

Informationen zu Bewertungen

Zur Abgabe einer Bewertung ist eine Anmeldung im Konto notwendig. Die Authentizität der Bewertungen wird von uns nicht überprüft. Wir behalten uns vor, Bewertungstexte, die unseren Richtlinien widersprechen, entsprechend zu kürzen oder zu löschen.

Verfassen Sie die erste Bewertung zu diesem Artikel

Helfen Sie anderen Kund*innen durch Ihre Meinung

Erste Bewertung verfassen

Unsere Kundinnen und Kunden meinen

0.0

0 Bewertungen filtern

Weitere Artikel finden Sie in

EinleitungViele Diätformen kommen eine Zeitlang auf, um dann wieder zu verschwinden. Die vitale vegetabile Frischkostdiät die Sie in diesem Handbuch kennen lernen werden, basiert dagegen auf solider wissenschaftliche Grundlage, die sich in den letzten 100 Jahren nur bestätigt und vertieft hat. Am Ende des 19. Jahrhunderts entdeckte Dr.med. Maximilian Bircher-Benner, entgegen all seinen Erwartungen, fast zufällig die hohe Wirksamkeit ganz frisch zubereiteter, lebendiger Vegetabilien, wenn es um die Verhütung und Heilung der heute immer häufiger und immer früher auftretenden chronischen Krankheiten geht. Nach mehreren Jahren klinischer Erforschung, erkannte er, dass die lebendigen Vegetabilien eine ganz andere Nahrungsenergie enthalten müssen als die Verbrennungswärme (Kalorien). Bereits 1905 veröffentlichte er in Berlin seine erste, viel beachtete Ernährungslehre , nachdem er erkannt hatte, dass die Kalorien, das Mass der Wärmeenergie, die durch Verbrennung der Nahrungsmittel bestimmt wurde, zum Verständnis der Nahrungsenergie nicht ausreichen. Die erstaunliche, heilende Wirkung seiner Diät erklärte er auf Grund seiner wissenschaftlicher Nachforschungen über mehrere Jahre mit dem zweiten Hauptsatz der Thermodynamik, dem Entropiegesetz . In der Tat ist es erstaunlich, dass unsere moderne medizinische Wissenschaft auch heute noch immer als einziges Mass für die Nahrungsenergie die Kalorien, die Verbrennungswärme kennt, während der zweite Hauptsatz der Thermodynamik auf allen anderen wissenschaftlichen Gebieten, in der Technik, der Physik und der Chemie seit 150 Jahren zur Basis aller energetischen Betrachtungen geworden ist. Am Anfang des 20 Jahrhunderts, beherrschte die Furcht vor Ansteckung durch Bakterien die medizinische Welt, so dass man glaubte, es sei besser, alle Nahrung vor dem Verzehr zu kochen. Daraus ergaben sich neue Forderungen hygienischer Zubereitung der Rohkost. Als dann hitzelabile Vitamine und Vitalstoffe entdeckt wurden, bahnte sich Bircher-Benners Rohkostdiät ihren Weg zu weltweiter Anerkennung. Die Erforschung der LASER-Amplifikation der Photonen in der Erbsubstanz der lebendigen Zellen ,5,6, und der Informationsleitung und -speicherung in der Grundsubstanz des Bindegewebes bestätigen Bircher-Benners Hypothese der Lichtakkumulation in lebendigen Nahrungsmitteln und der enormen Bedeutung der Photosynthese für den Energiewert der Nahrungsmittel als ordnende und damit heilende Information. Eine weitere Bestätigung aus der Grundlagenforschung brachten unter anderem die Arbeiten des Nobelpreisträgers Ilya Prigogine über das dissipative System der lebenden Zellen, welche zeigten, dass das Streben aller physikalischen Vorgänge nach Unordnung (Entropiegesetz) in den lebendigen Zellen nicht gilt, da sie durch die Speicherung der Photonen aus der Photosynthese und die enorme rhythmische Verstärkung dieses Lichtes in den Zellen nach dem LASER-Prinzip in ihrer Energie so weit vom thermodynamischen Gleichgewicht entfernt werden, dass der zweite Hauptsatz der Energetik nicht gilt und das Chaosprinzip in ein ordnendes Kohärenzprinzip umschlägt. In der Tat sind alle lebendigen Zellen der Natur der einzige Ort, wo aus kleinen, einfachen Molekülen komplexe, hochgeordnete Moleküle, Abläufe und Strukturen entstehen: wo aus Chaos Ordnung wird. Dies ist die grosse Bedeutung der Rohkostdiät, als einzige Diät, welche das ordnende Prinzip und die Ordnende Wirkung der lebendigen Zellen auf unser biologisches System überträgt und damit ihre grosse ordnende Heilwirkung entfaltet. Hinzu kommt die hohe Nahrungsökonomie der lebendigen Pflanzennahrung, in welcher alle Nahrungsstoffe in geeigneten Mengenverhältnissen organisch gebunden und dadurch biologisch in höchstem Masse verfügbar werden, und wo die für die Assimilation der Vitalstoffe notwendigen Enzyme zugleich mitgeliefert sind, ihr hoher Gehalt an Polyphenolen, Carotinen und anderen Antioxidantien mit ihrer grossen, vor Degeneration und vor Genmutationen und dami
  • Bircher-Benner: (Hand)buch Nr. 4 für Frischsäfte, Rohkost und Früchtspeisen
  • Inhaltsverzeichnis zu „Bircher-Benner-Handbuch: Bd.4 Bircher-Benner Handbuch für Frischsäfte, Rohkost und Früchtespeisen“
    Einleitung 5
    Zweierlei Nahrungsenergie7
    Die neue Ordnung der Nahrungsmittel nach ihrem qualitiven Nährwert 9
    Das Grundsystem des zarten Bindegewebes, Ursprung der Entstehung chronischer Krankheiten 11
    Das Experiment im Royal Free Hospital in London 15
    Einige weitere ausgewählte Beispiele wissenschaftlicher Untersuchungen zur Wirkung der Rohkosttherapie 19
    Sekundäre Pflanzenstoffe, Arzneiwirkung pflanzlicher Nahrungsmittel 21
    Zur Rohkosttherapie bei Gefahr von Thrombose und Embolie 26
    Besonderheiten der Rohkosttherapie gegen Bluthochdruck 26
    Besonderheiten der Rohkosttherapie zur Senkung des Cholesterinsspiegels 27
    Zur Rohkosttherapie bei Diabetes mellitus 27
    Zur Rohkosttherapie bei Infektionskrankheiten antimikrobielle Wirkung) 29
    Zur Rohkosttherapie bei Immunschwäche und Infekt
    anfälligkeit 29
    Die Indikation zur Diät mit vegetabiler Frischkost
    (Rohkost) 30
    Die Diätstufe 1 32
    Die Diätstufe 2 34
    Formen vegetabiler Frischkost 35
    Reaktionen auf die Umstellung auf die vegetabilen
    Frischkostdiät und ihre Behandlung 37
    Begleitende, allgemeine Empfehlungen zur vegetabilen
    Frischsaftdiät 40
    Die neue Gleichgewichtslage 41
    Die verjüngende Wirkung der vitalen vegetabilen
    Frischkost 44
    Die richtige Anfangsdosierung 45
    Das Thema der sogenannten "Rohkostintoleranz" 47
    Die Zubereitung und Reinigung der Rohkost 47
    Die Zusammenstellung der Rohkost 48
    Die Anpassung an Geschmack und Kaufähigkeit 48
    Die Reinigung der Rohkost 49
    Von der Bircher-Raffel zur elektrischen Küchenmaschine 50
    Speisezettel 51
    Menü-Zusammenstellungen bei verschiedenen
    Rohkost-Diätformen 51
    Die Rezepte 55
    Müesli 55
    Früchte-Frischkorn-Speisen 57
    Früchte-Speisen 57
    Säfte 59
    Schleim als Zusatz zu Säften 60
    Milcharten 61
    Saucen zu Rohgemüsen 62
    Salatgerichte 62
    Gesundheits-Tees 65
    Stichwortverzeichnis 67
    Literaturverzeichnis 68